PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta011720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HB-other
Protein Properties Length: 185aa    MW: 21789.6 Da    PI: 10.0574
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pta#S26640961PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.65e-192478357
               --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
   Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
               kR   t+eqle Le+ ++ ++yp ++ r +L+++l+L++rq ++WF+ rR k+kk
  Pta011720 24 KRKMKTPEQLELLEKTYAADNYPPEHVRSQLSERLKLSDRQLQMWFCHRRLKDKK 78
               89999************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-18479IPR009057Homeodomain-like
SuperFamilySSF466891.71E-161379IPR009057Homeodomain-like
PROSITE profilePS5007116.181979IPR001356Homeobox domain
SMARTSM003898.1E-152183IPR001356Homeobox domain
PfamPF000461.5E-162478IPR001356Homeobox domain
CDDcd000866.70E-112473No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MDSEGERKLQ PQHVSSSQED KNPKRKMKTP EQLELLEKTY AADNYPPEHV RSQLSERLKL  60
SDRQLQMWFC HRRLKDKKER EKEKERETEK EKEKEKEREK EKEKQPKKRK PNLRLXLPPP  120
PPPPPPPLAA PAHSVSLMPT ATKTNFYDDY DARKRPPLKL NCEGGGGWEK KSQPQNLQLH  180
PTELL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17178RRLKDKKE
2103109KQPKKRK